missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAP1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | DAP1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:20-1:100, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18690772
|
Novus Biologicals
NBP2-92897-0.02ml |
0.02 mL |
£161.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651692
|
Novus Biologicals
NBP2-92897-0.1ml |
0.1 mL |
£359.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DAP1 Polyclonal antibody specifically detects DAP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| DAP1 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cellular Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 1611 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:20-1:100, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DAP1, DAP-1, death-associated protein, death-associated protein 1, MGC99796 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1). MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title