DAP1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92897-0.1ml

Product Code. 18651692

Description

DAP1 Polyclonal antibody specifically detects DAP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: DAP1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:20-1:100, Immunohistochemistry-Paraffin
• Gene Alias: DAP1, DAP-1, death-associated protein, death-associated protein 1, MGC99796
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1). MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cellular Markers
• Gene ID (Entrez): 1611
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified