missing translation for 'onlineSavingsMsg'
Learn More
Learn More
D4S234E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | D4S234E |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
D4S234E Polyclonal specifically detects D4S234E in Human samples. It is validated for Western Blot.Specifications
| D4S234E | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, D4S234Brain neuron cytoplasmic protein 1, DNA segment on chromosome 4 (unique) 234 expressed sequence, NEEP21, neuron-specific protein family member 1, NSG1, P21 | |
| NSG1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001035190 | |
| 27065 | |
| Synthetic peptide directed towards the N terminal of human D4S234E. Peptide sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title