missing translation for 'onlineSavingsMsg'
Learn More
Learn More
D4S234E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80544
This item is not returnable.
View return policy
Description
D4S234E Polyclonal specifically detects D4S234E in Human samples. It is validated for Western Blot.
Specifikationer
| D4S234E | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, D4S234Brain neuron cytoplasmic protein 1, DNA segment on chromosome 4 (unique) 234 expressed sequence, NEEP21, neuron-specific protein family member 1, NSG1, P21 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%. | |
| Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_001035190 | |
| NSG1 | |
| Synthetic peptide directed towards the N terminal of human D4S234E. Peptide sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT. | |
| 100 μL | |
| Signal Transduction | |
| 27065 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering