missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Cytosolic Sulfotransferase 1C4/SULT1C4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cytosolic Sulfotransferase 1C4/SULT1C4 Polyclonal specifically detects Cytosolic Sulfotransferase 1C4/SULT1C4 in Human samples. It is validated for Western Blot.Specifications
| Cytosolic Sulfotransferase 1C4/SULT1C4 | |
| Polyclonal | |
| Rabbit | |
| O75897 | |
| 27233 | |
| Synthetic peptides corresponding to SULT1C4(sulfotransferase family, cytosolic, 1C, member 4) The peptide sequence was selected from the middle region of SULT1C4. Peptide sequence HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2 | |
| SULT1C4 | |
| IgG | |
| 35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts