Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52893

Product Code. 18223453

Description

Cytosolic Sulfotransferase 1C4/SULT1C4 Polyclonal specifically detects Cytosolic Sulfotransferase 1C4/SULT1C4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytosolic Sulfotransferase 1C4/SULT1C4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, MGC149521, MGC34422, ST1C4, Sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2, SULT1C#2, SULT1C2cytosolic, 1C, member 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%.
• Target Species: Human, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75897
• Gene Symbols: SULT1C4
• Immunogen: Synthetic peptides corresponding to SULT1C4(sulfotransferase family, cytosolic, 1C, member 4) The peptide sequence was selected from the middle region of SULT1C4. Peptide sequence HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27233
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.