missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytokeratin 75 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Cytokeratin 75 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cytokeratin 75 Polyclonal specifically detects Cytokeratin 75 in Human samples. It is validated for Western Blot.Specifications
| Cytokeratin 75 | |
| Polyclonal | |
| Rabbit | |
| O95678 | |
| 9119 | |
| Synthetic peptides corresponding to Cytokeratin 75 The peptide sequence was selected from the N terminal of Cytokeratin 75. Peptide sequence MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CK-75, Cytokeratin-75, hK6hf, K6HFcytokeratin type II, K75, KB18, keratin 75, keratin, type II cytoskeletal 75, Keratin-6 hair follicle, Keratin-75, PFB, type II keratin-18, Type II keratin-K6hf, Type-II keratin Kb18 | |
| KRT75 | |
| IgG | |
| 59 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title