Cytokeratin 75 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55236

Product Code. 18299584

Description

Cytokeratin 75 Polyclonal specifically detects Cytokeratin 75 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytokeratin 75
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CK-75, Cytokeratin-75, hK6hf, K6HFcytokeratin type II, K75, KB18, keratin 75, keratin, type II cytoskeletal 75, Keratin-6 hair follicle, Keratin-75, PFB, type II keratin-18, Type II keratin-K6hf, Type-II keratin Kb18
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 86%; Porcine: 85%; Bovine: 79%; .
• Target Species: Human, Mouse, Rat, Pig, Bovine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95678
• Gene Symbols: KRT75
• Immunogen: Synthetic peptides corresponding to Cytokeratin 75 The peptide sequence was selected from the N terminal of Cytokeratin 75. Peptide sequence MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9119
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.