missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytohesin 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Cytohesin 4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cytohesin 4 Polyclonal specifically detects Cytohesin 4 in Human samples. It is validated for Western Blot.Specifications
| Cytohesin 4 | |
| Polyclonal | |
| Rabbit | |
| Q9UIA0 | |
| 27128 | |
| Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1 | |
| CYTH4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title