Cytohesin 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56913

Product Code. 18266623

Description

Cytohesin 4 Polyclonal specifically detects Cytohesin 4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytohesin 4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CYT4PH, SEC7 and coiled-coil domain-containing protein 4, cytohesin 4, cytohesin-4, pleckstrin homology, Sec7 and coiled/coil domains 4, pleckstrin homology, Sec7 and coiled-coil domains 4, PSCD4DJ63G5.1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27128
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UIA0
• Gene Symbols: CYTH4
• Immunogen: Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Western clawed frog: 90%; Xenopus: 90%; Zebrafish: 90%; Rainbow smelt: 90%; Atlantic salmon: 78%; Green puffer: 78%; Chicken: 78%; Green monkey: 78%; Human: 100%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG