missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytochrome P450 2D6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00
Specifications
| Antigen | Cytochrome P450 2D6 |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Cytochrome P450 2D6 Polyclonal specifically detects Cytochrome P450 2D6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cytochrome P450 2D6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1565 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CPD6P450DB1, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, cytochrome P450 2D6, cytochrome P450, family 2, subfamily D, polypeptide 6, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2, cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, EC 1.14.14.1, flavoprotein-linked monooxygenase, -metabolizing)-like 1, MGC120389, MGC120390, microsomal monooxygenase, P450C2D, P450-DB1, polypeptide 6, polypeptide 7 pseudogene 2, polypeptide 8 pseudogene 2, xenobiotic monooxygenase | |
| CYP2D6 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title