Cytochrome P450 2D6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91818-25ul

Product Code. 18493332

Description

Cytochrome P450 2D6 Polyclonal specifically detects Cytochrome P450 2D6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytochrome P450 2D6
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CPD6P450DB1, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, cytochrome P450 2D6, cytochrome P450, family 2, subfamily D, polypeptide 6, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2, cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, EC 1.14.14.1, flavoprotein-linked monooxygenase, -metabolizing)-like 1, MGC120389, MGC120390, microsomal monooxygenase, P450C2D, P450-DB1, polypeptide 6, polypeptide 7 pseudogene 2, polypeptide 8 pseudogene 2, xenobiotic monooxygenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1565
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CYP2D6
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only