missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytochrome P450 2C8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88055
This item is not returnable.
View return policy
Description
Cytochrome P450 2C8 Polyclonal specifically detects Cytochrome P450 2C8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Cytochrome P450 2C8 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CPC8, CYPIIC8, cytochrome P450 2C8, Cytochrome P450 form 1, Cytochrome P450 IIC2, Cytochrome P450 MP-12, Cytochrome P450 MP-20, cytochrome P450, family 2, subfamily C, polypeptide 8, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, MP-12/MP-20, P450 form 1, S-mephenytoin 4-hydroxylase, xenobiotic monooxygenase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CYP2C8 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV | |
| 0.1 mL | |
| Lipid and Metabolism | |
| 1558 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction