missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cysteinyl Leukotriene R2/CysLTR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13897
This item is not returnable.
View return policy
Description
Cysteinyl Leukotriene R2/CysLTR2 Polyclonal antibody specifically detects Cysteinyl Leukotriene R2/CysLTR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Cysteinyl Leukotriene R2/CysLTR2 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CysLT(2), CYSLT2KPG_011, CYSLT2RHG57, CysLTR2, cysteinyl leukotriene CysLT2 receptor, cysteinyl leukotriene receptor 2, G protein-coupled receptor, G-protein coupled receptor GPCR21, G-protein coupled receptor HG57, hGPCR21, HPN321 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE | |
| 0.1 mL | |
| GPCR | |
| 57105 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction