missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cystatin-8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Cystatin-8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Cystatin-8 Polyclonal specifically detects Cystatin-8 in Human samples. It is validated for Western Blot.Specifications
| Cystatin-8 | |
| Polyclonal | |
| Rabbit | |
| O60676 | |
| 10047 | |
| Synthetic peptides corresponding to CST8(cystatin 8 (cystatin-related epididymal specific)) The peptide sequence was selected from the middle region of CST8. Peptide sequence LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific | |
| CST8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title