Cystatin-8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57663

Product Code. 18204982

Description

Cystatin-8 Polyclonal specifically detects Cystatin-8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cystatin-8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10047
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60676
• Gene Symbols: CST8
• Immunogen: Synthetic peptides corresponding to CST8(cystatin 8 (cystatin-related epididymal specific)) The peptide sequence was selected from the middle region of CST8. Peptide sequence LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Canine: 92%; Pig: 91%; Bovine: 90%; Rabbit: 85%; Rat: 84%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG