missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cystatin-8 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | Cystatin-8 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639251
|
Novus Biologicals
NBP2-92605-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630682
|
Novus Biologicals
NBP2-92605-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cystatin-8 Polyclonal antibody specifically detects Cystatin-8 in Mouse samples. It is validated for Western BlotSpecifications
| Cystatin-8 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS with 50% glycerol, pH7.3. | |
| 10047 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 53-142 of human CST8 (NP_005483.1). MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title