missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP27C1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CYP27C1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CYP27C1 Polyclonal specifically detects CYP27C1 in Human samples. It is validated for Western Blot.Specifications
| CYP27C1 | |
| Polyclonal | |
| Rabbit | |
| Q4G0S4 | |
| 339761 | |
| Synthetic peptides corresponding to CYP27C1(cytochrome P450, family 27, subfamily C, polypeptide 1) The peptide sequence was selected from the middle region of CYP27C1. Peptide sequence VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cytochrome P450 27C1, cytochrome P450, family 27, subfamily C, polypeptide 1, cytochrome P450, family 27, subfamily C, polypeptide 13, EC 1.14, FLJ16008 | |
| CYP27C1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title