CYP27C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56523

Product Code. 18245824

Description

CYP27C1 Polyclonal specifically detects CYP27C1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CYP27C1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cytochrome P450 27C1, cytochrome P450, family 27, subfamily C, polypeptide 1, cytochrome P450, family 27, subfamily C, polypeptide 13, EC 1.14, FLJ16008
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 339761
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q4G0S4
• Gene Symbols: CYP27C1
• Immunogen: Synthetic peptides corresponding to CYP27C1(cytochrome P450, family 27, subfamily C, polypeptide 1) The peptide sequence was selected from the middle region of CYP27C1. Peptide sequence VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 85%; Rabbit: 85%; Chicken: 76%.
• Target Species: Human, Bovine, Canine, Equine, Rabbit
• Isotype: IgG