missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP27A1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | CYP27A1 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30233039
|
Novus Biologicals
NBP3-33416-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30226682
|
Novus Biologicals
NBP3-33416-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CYP27A1 Monoclonal antibody specifically detects CYP27A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| CYP27A1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1593 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 12-alpha-triol 27-hydroxylase, 7-alpha, cholestanetriol 26-monooxygenase, CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase, CTX5-beta-cholestane-3-alpha, CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase, Cytochrome P450 27, cytochrome P450, family 27, subfamily A, polypeptide 1, cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1, Cytochrome P-450C27/25, EC 1.14.13.15, sterol 26-hydroxylase, mitochondrial, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase | |
| A synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1).,, Sequence:, VSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title