CYP27A1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33416-20ul

Product Code. 30233039

Description

CYP27A1 Monoclonal antibody specifically detects CYP27A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: CYP27A1
• Classification: Monoclonal
• Dilution: Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: 12-alpha-triol 27-hydroxylase, 7-alpha, cholestanetriol 26-monooxygenase, CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase, CTX5-beta-cholestane-3-alpha, CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase, Cytochrome P450 27, cytochrome P450, family 27, subfamily A, polypeptide 1, cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1, Cytochrome P-450C27/25, EC 1.14.13.15, sterol 26-hydroxylase, mitochondrial, Sterol 27-hydroxylase, Vitamin D(3) 25-hydroxylase
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1).,, Sequence:, VSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQ
• Quantity: 20 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 1593
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified