missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclophilin 40 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85363
This item is not returnable.
View return policy
Description
Cyclophilin 40 Polyclonal specifically detects Cyclophilin 40 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Cyclophilin 40 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20-1:50, Immunohistochemistry-Paraffin 1:20-1:50 | |
| 40 kDa peptidyl-prolyl cis-trans isomerase, 40 kDa peptidyl-prolyl cis-trans isomerase D, cyclophilin D, Cyclophilin-40, Cyclophilin-related protein, CYP40, CYP-40cyclophilin 40, CYPD, EC 5.2.1.8, MGC33096, peptidyl-prolyl cis-trans isomerase D, peptidylprolyl isomerase D, peptidylprolyl isomerase D (cyclophilin D), PPIase D, Rotamase D | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PPID | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPE | |
| 0.1 mL | |
| Immunology | |
| 5481 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction