missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cyclophilin 40 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | Cyclophilin 40 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:20-1:50, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18477761
|
Novus Biologicals
NBP1-85363-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18253666
|
Novus Biologicals
NBP1-85363 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cyclophilin 40 Polyclonal specifically detects Cyclophilin 40 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cyclophilin 40 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 40 kDa peptidyl-prolyl cis-trans isomerase, 40 kDa peptidyl-prolyl cis-trans isomerase D, cyclophilin D, Cyclophilin-40, Cyclophilin-related protein, CYP40, CYP-40cyclophilin 40, CYPD, EC 5.2.1.8, MGC33096, peptidyl-prolyl cis-trans isomerase D, peptidylprolyl isomerase D, peptidylprolyl isomerase D (cyclophilin D), PPIase D, Rotamase D | |
| PPID | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20-1:50, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5481 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title