missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYB5R4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£386.00
Specifications
| Antigen | CYB5R4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CYB5R4 Polyclonal specifically detects CYB5R4 in Mouse samples. It is validated for Western Blot.Specifications
| CYB5R4 | |
| Polyclonal | |
| Rabbit | |
| b5+b5R, cb5/cb5R, cytochrome b5 reductase 4, cytochrome b-type NAD(P)H oxidoreductase, dJ676J13.1, EC 1.6.2.2, Flavohemoprotein b5/b5R, flavohemoprotein b5+b5R, NADPH cytochrome B5 oxidoreductase, NCB5ORN-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containingprotein, RP4-676J13.1 | |
| CYB5R4 | |
| IgG | |
| 62 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 51167 | |
| Synthetic peptides corresponding to the N terminal of Cyb5r4. Immunizing peptide sequence PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title