CYB5R4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74118

Product Code. 18275893

Description

CYB5R4 Polyclonal specifically detects CYB5R4 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: CYB5R4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CYB5R4
• Immunogen: Synthetic peptides corresponding to the N terminal of Cyb5r4. Immunizing peptide sequence PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51167
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: b5+b5R, cb5/cb5R, cytochrome b5 reductase 4, cytochrome b-type NAD(P)H oxidoreductase, dJ676J13.1, EC 1.6.2.2, Flavohemoprotein b5/b5R, flavohemoprotein b5+b5R, NADPH cytochrome B5 oxidoreductase, NCB5ORN-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containingprotein, RP4-676J13.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 62 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Bovine: 79%; Rabbit: 79%; Rat: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG