missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CXXC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | CXXC5 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18224513
|
Novus Biologicals
NBP2-58775 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18679526
|
Novus Biologicals
NBP2-58775-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CXXC5 Polyclonal specifically detects CXXC5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| CXXC5 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibitor of Dishevelled | |
| CXXC5 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 51523 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title