CUGBP1/CELF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18664650	Novus Biologicals NBP2-76536-25ul	25 μL
18299088	Novus Biologicals NBP2-76536	100 μL

Description

CUGBP1/CELF1 Polyclonal specifically detects CUGBP1/CELF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CUGBP1/CELF1
• Conjugate: Unconjugated
• Target Species: Human
• Gene Alias: BRUNOL250 kDa nuclear polyadenylated RNA-binding protein, bruno-like 2, Bruno-like protein 2, CUG RNA-binding protein, CUG triplet repeat, RNA binding protein 1, CUG triplet repeat, RNA-binding protein 1, CUG-BP, CUG-BP- and ETR-3-like factor 1, CUGBP Elav-like family member 1, CUGBP, Elav-like family member 1, CUGBP1CUG triplet repeat RNA-binding protein 1, CUGBPCELF-1, Deadenylation factor CUG-BP, EDEN-BP, EDEN-BP homolog, embryo deadenylation element binding protein, Embryo deadenylation element-binding protein homolog, hNab50, NAB50CUG-BP1, NAPOR, nuclear polyadenylated RNA-binding protein, 50-kD, RNA-binding protein BRUNOL-2
• Gene Symbols: CELF1
• Isotype: IgG
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene ID (Entrez): 10658
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.