missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CUGBP1/CELF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76536
This item is not returnable.
View return policy
Description
CUGBP1/CELF1 Polyclonal specifically detects CUGBP1/CELF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| CUGBP1/CELF1 | |
| Polyclonal | |
| Western Blot 0.4 μ/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL | |
| BRUNOL250 kDa nuclear polyadenylated RNA-binding protein, bruno-like 2, Bruno-like protein 2, CUG RNA-binding protein, CUG triplet repeat, RNA binding protein 1, CUG triplet repeat, RNA-binding protein 1, CUG-BP, CUG-BP- and ETR-3-like factor 1, CUGBP Elav-like family member 1, CUGBP, Elav-like family member 1, CUGBP1CUG triplet repeat RNA-binding protein 1, CUGBPCELF-1, Deadenylation factor CUG-BP, EDEN-BP, EDEN-BP homolog, embryo deadenylation element binding protein, Embryo deadenylation element-binding protein homolog, hNab50, NAB50CUG-BP1, NAPOR, nuclear polyadenylated RNA-binding protein, 50-kD, RNA-binding protein BRUNOL-2 | |
| Rabbit | |
| 100 μL | |
| 10658 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| CELF1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction