missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CUEDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | CUEDC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
CUEDC1 Polyclonal specifically detects CUEDC1 in Human samples. It is validated for Western Blot.Specifications
| CUEDC1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| CUE domain containing 1, CUE domain-containing protein 1, DKFZp547L163, FLJ20739 | |
| CUEDC1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q9NWM3 | |
| 404093 | |
| Synthetic peptides corresponding to CUEDC1(CUE domain containing 1) The peptide sequence was selected from the middle region of CUEDC1. Peptide sequence RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title