CUEDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57682

Product Code. 18281805

Description

CUEDC1 Polyclonal specifically detects CUEDC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CUEDC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CUE domain containing 1, CUE domain-containing protein 1, DKFZp547L163, FLJ20739
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 404093
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NWM3
• Gene Symbols: CUEDC1
• Immunogen: Synthetic peptides corresponding to CUEDC1(CUE domain containing 1) The peptide sequence was selected from the middle region of CUEDC1. Peptide sequence RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%; Chicken: 91%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified