CTR9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57251-25ul

Product Code. 18643388

Description

CTR9 Polyclonal specifically detects CTR9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CTR9
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae), KIAA0155SH2 domain-binding protein 1, p150TSP, RNA polymerase-associated protein CTR9 homolog, SH2 domain binding protein 1 (tetratricopeptide repeat containing), SH2BP1p150, TPR-containing, SH2-binding phosphoprotein, TSBP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CTR9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQT
• Quantity: 25 μL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 9646
• Target Species: Human
• Form: Purified

For Research Use Only