missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTR2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | CTR2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667461
|
Novus Biologicals
NBP2-92317-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626841
|
Novus Biologicals
NBP2-92317-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CTR2 Polyclonal antibody specifically detects CTR2 in Mouse samples. It is validated for Western BlotSpecifications
| CTR2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 1318 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| Copper transporter 2, COPT2SLC13A2, CTR2Solute carrier family 31 member 2, hCTR2probable low affinity copper uptake protein 2, solute carrier family 31 (copper transporters), member 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1). MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title