missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CTR2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92317-0.02ml
This item is not returnable.
View return policy
Description
CTR2 Polyclonal antibody specifically detects CTR2 in Mouse samples. It is validated for Western Blot
Specifications
| CTR2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Copper transporter 2, COPT2SLC13A2, CTR2Solute carrier family 31 member 2, hCTR2probable low affinity copper uptake protein 2, solute carrier family 31 (copper transporters), member 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1). MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI | |
| 0.02 mL | |
| Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction | |
| 1318 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction