Ctip1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18324087	Novus Biologicals NBP3-17030-25UL	25 μg
18334924	Novus Biologicals NBP3-17030-100UL	100 μg

Description

Ctip1 Polyclonal antibody specifically detects Ctip1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Ctip1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Apoptosis, Cancer, Inhibitors Activators and Regulators, Transcription Factors and Regulators, Tumor Suppressors
• Formulation: PBS, pH 7.2, 40% glycerol
• Gene ID (Entrez): 53335
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: B-cell CLL/lymphoma 11A, B-cell CLL/lymphoma 11A (zinc finger protein), B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2, B-cell lymphoma/leukemia 11A, BCL-11A, BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1, BCL11A-S, BCL11A-XL, C2H2-type zinc finger protein, COUP-TF-interacting protein 1, CTIP1ecotropic viral integration site 9, ecotropic viral integration site 9 homolog, Ecotropic viral integration site 9 protein homolog, EVI-9, EVI9FLJ34997, HBFQTL5, KIAA1809BCL11A-L, Zinc finger protein 856, ZNF856FLJ10173
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGC
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.