missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ctip1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Ctip1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18324087 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18324087 25 μg 25µL
18334924 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18324087 Supplier Novus Biologicals Supplier No. NBP31703025UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Ctip1 Polyclonal antibody specifically detects Ctip1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Ctip1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias B-cell CLL/lymphoma 11A, B-cell CLL/lymphoma 11A (zinc finger protein), B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2, B-cell lymphoma/leukemia 11A, BCL-11A, BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1, BCL11A-S, BCL11A-XL, C2H2-type zinc finger protein, COUP-TF-interacting protein 1, CTIP1ecotropic viral integration site 9, ecotropic viral integration site 9 homolog, Ecotropic viral integration site 9 protein homolog, EVI-9, EVI9FLJ34997, HBFQTL5, KIAA1809BCL11A-L, Zinc finger protein 856, ZNF856FLJ10173
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: HENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGC
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Inhibitors Activators and Regulators, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 53335
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.