missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSRP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CSRP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CSRP2 Polyclonal specifically detects CSRP2 in Human samples. It is validated for Western Blot.Specifications
| CSRP2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers | |
| CRP2LIM domain only protein 5, cysteine and glycine-rich protein 2, Cysteine-rich protein 2, LMO5LMO-5, SMLIM, SmLIMLIM domain only 5, smooth muscle, Smooth muscle cell LIM protein | |
| CSRP2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001312 | |
| 1466 | |
| Synthetic peptide directed towards the C terminal of human CSRP2. Peptide sequence FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title