CSRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80293

Product Code. 18263807

Description

CSRP2 Polyclonal specifically detects CSRP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CSRP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CRP2LIM domain only protein 5, cysteine and glycine-rich protein 2, Cysteine-rich protein 2, LMO5LMO-5, SMLIM, SmLIMLIM domain only 5, smooth muscle, Smooth muscle cell LIM protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001312
• Gene Symbols: CSRP2
• Immunogen: Synthetic peptide directed towards the C terminal of human CSRP2. Peptide sequence FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers
• Gene ID (Entrez): 1466
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.