missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CSGLCAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CSGLCAT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CSGLCAT Polyclonal specifically detects CSGLCAT in Human samples. It is validated for Western Blot.Specifications
| CSGLCAT | |
| Polyclonal | |
| Rabbit | |
| 54480 | |
| Synthetic peptides corresponding to CSGLCA-T The peptide sequence was selected from the N terminal of CSGLCA-T. Peptide sequence SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CHPF2 | |
| IgG | |
| 18 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title