CSGLCAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55085

Product Code. 18299942

Description

CSGLCAT Polyclonal specifically detects CSGLCAT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CSGLCAT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CHPF2
• Immunogen: Synthetic peptides corresponding to CSGLCA-T The peptide sequence was selected from the N terminal of CSGLCA-T. Peptide sequence SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54480
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Chondroitin glucuronyltransferase, chondroitin polymerizing factor 2KIAA1402chPF-2, Chondroitin synthase 3, chondroitin synthase-3, ChPF-2, CHSY3, ChSy-3chondroitin sulfate glucuronyltransferase, CSGlcA-T, CSGLCAT, EC 2.4.1.226, N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 79%; Porcine: 79%.
• Target Species: Human, Pig, Canine, Equine, Rabbit
• Isotype: IgG