CSDE1 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33278-100ul

Product Code. 30231789

Description

CSDE1 Monoclonal antibody specifically detects CSDE1 in Human,Mouse samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: CSDE1
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: cold shock domain containing E1, RNA-binding, cold shock domain-containing protein E1, D1S155EUNRRP5-1000E10.3, DKFZp779B0247, DKFZp779J1455, FLJ26882, KIAA0885, N-ras upstream gene protein, NRAS-related, NRU, Protein UNR, upstream of NRAS
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CSDE1 (NP_009089.4).,, Sequence:, MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERM
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7812
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG