missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CROCCL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CROCCL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CROCCL2 Polyclonal specifically detects CROCCL2 in Human samples. It is validated for Western Blot.Specifications
| CROCCL2 | |
| Polyclonal | |
| Rabbit | |
| ciliary rootlet coiled-coil, rootletin pseudogene 3, CROCCL2, dJ798A10.2, KIAA0445, KIAA1922 | |
| CROCCP3 | |
| IgG | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 114819 | |
| Synthetic peptide directed towards the N terminal of human CROCCL2The immunogen for this antibody is CROCCL2. Peptide sequence NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title