CROCCL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79470

Product Code. 18215337

Description

CROCCL2 Polyclonal specifically detects CROCCL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CROCCL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CROCCP3
• Immunogen: Synthetic peptide directed towards the N terminal of human CROCCL2The immunogen for this antibody is CROCCL2. Peptide sequence NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114819
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ciliary rootlet coiled-coil, rootletin pseudogene 3, CROCCL2, dJ798A10.2, KIAA0445, KIAA1922
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence Mouse: 85%; Guinea pig: 83%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG