missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
CROCCL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79470
Denne vare kan ikke returneres.
Se returpolicy
Beskrivelse
CROCCL2 Polyclonal specifically detects CROCCL2 in Human samples. It is validated for Western Blot.
Tekniske data
| CROCCL2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CROCCP3 | |
| Synthetic peptide directed towards the N terminal of human CROCCL2The immunogen for this antibody is CROCCL2. Peptide sequence NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG. | |
| Affinity purified | |
| RUO | |
| 114819 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| ciliary rootlet coiled-coil, rootletin pseudogene 3, CROCCL2, dJ798A10.2, KIAA0445, KIAA1922 | |
| Rabbit | |
| 47 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence Mouse: 85%; Guinea pig: 83%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion