missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRHR1/CRF1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05630-20ul
This item is not returnable.
View return policy
Description
CRHR1/CRF1 Polyclonal antibody specifically detects CRHR1/CRF1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| CRHR1/CRF1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| corticotropin releasing hormone receptor 1, corticotropin-releasing factor receptor 1, corticotropin-releasing factor type 1 receptor, Corticotropin-releasing hormone receptor 1, CRF1, CRFR, CRF-R, CRFR1, CRF-R1, CRF-R-1, CRFR-1, CRH-R-1, CRHR1f, CRH-R1h, CRHR1L, CRHRCRH-R1, seven transmembrane helix receptor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human CRHR1/CRF1 (NP_001138618.1). SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV | |
| 20 μg | |
| GPCR, Neuroscience, Neurotransmission | |
| 1394 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction