CRHR1/CRF1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-05630-100ul

Product Code. 18630508

Description

CRHR1/CRF1 Polyclonal antibody specifically detects CRHR1/CRF1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: CRHR1/CRF1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: corticotropin releasing hormone receptor 1, corticotropin-releasing factor receptor 1, corticotropin-releasing factor type 1 receptor, Corticotropin-releasing hormone receptor 1, CRF1, CRFR, CRF-R, CRFR1, CRF-R1, CRF-R-1, CRFR-1, CRH-R-1, CRHR1f, CRH-R1h, CRHR1L, CRHRCRH-R1, seven transmembrane helix receptor
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human CRHR1/CRF1 (NP_001138618.1). SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
• Quantity: 100 μg
• Research Discipline: GPCR, Neuroscience, Neurotransmission
• Gene ID (Entrez): 1394
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified