missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Creatine Kinase, Muscle/CKMM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Creatine Kinase, Muscle/CKMM |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Creatine Kinase, Muscle/CKMM Polyclonal specifically detects Creatine Kinase, Muscle/CKMM in Human, Mouse samples. It is validated for Western Blot.Specifications
| Creatine Kinase, Muscle/CKMM | |
| Polyclonal | |
| Rabbit | |
| P06732 | |
| CKM | |
| IgG | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 1158 | |
| Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the middle region of CKM. Peptide sequence GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title