Creatine Kinase, Muscle/CKMM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-52864

Product Code. 18238982

Description

Creatine Kinase, Muscle/CKMM Polyclonal specifically detects Creatine Kinase, Muscle/CKMM in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Creatine Kinase, Muscle/CKMM
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CKMMcreatine kinase M-type, Creatine Kinase Isoenzyme, Creatine kinase M chain, creatine kinase, muscle, creatine kinase-M, EC 2.7.3, EC 2.7.3.2, M-CK
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P06732
• Gene Symbols: CKM
• Immunogen: Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the middle region of CKM. Peptide sequence GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1158
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG