Creatine kinase MT 1B Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-05655-20ul

Product Code. 18639968

Description

Creatine kinase MT 1B Polyclonal antibody specifically detects Creatine kinase MT 1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Specifications

• Antigen: Creatine kinase MT 1B
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100, Immunoprecipitation 1:500 - 1:1000
• Gene Alias: Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
• Quantity: 20 μg
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 1159
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence, Immunoprecipitation
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified