missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Creatine kinase MT 1B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£150.00 - £359.00
Specifications
| Antigen | Creatine kinase MT 1B |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100, Immunoprecipitation 1:500 - 1:1000 |
| Applications | Western Blot, Immunofluorescence, Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18674618
|
Novus Biologicals
NBP3-05655-100ul |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639968
|
Novus Biologicals
NBP3-05655-20ul |
20 μg |
£150.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Creatine kinase MT 1B Polyclonal antibody specifically detects Creatine kinase MT 1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, ImmunoprecipitationSpecifications
| Creatine kinase MT 1B | |
| Western Blot, Immunofluorescence, Immunoprecipitation | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 1159 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100, Immunoprecipitation 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title