missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Creatine kinase MT 1B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05655-20ul
This item is not returnable.
View return policy
Description
Creatine kinase MT 1B Polyclonal antibody specifically detects Creatine kinase MT 1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Specifications
| Creatine kinase MT 1B | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100, Immunoprecipitation 1:500 - 1:1000 | |
| Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT | |
| 20 μg | |
| Stem Cell Markers | |
| 1159 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence, Immunoprecipitation | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction