missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPXCR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CPXCR1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CPXCR1 Polyclonal specifically detects CPXCR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CPXCR1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CPX chromosomal region candidate gene 1 protein, CPX chromosome region, candidate 1, CT77Cancer/testis antigen 77 | |
| CPXCR1 | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| NP_149037 | |
| 53336 | |
| Synthetic peptide directed towards the middle region of human CPXCR1. Peptide sequence WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title